Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc sp. Photosystem Q (B) protein 1

This Recombinant Nostoc sp. Photosystem Q (B) protein 1 spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 1, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 1, Photosystem II protein D1 1

UniProt

P46242

Expression Region

1-344

Origin

Nostoc sp. (strain PCC 7120 / UTEX 2576)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTLQQRSSANVWERFCTWITSTENRIYVGWFGVLMIPTLLAATVCFIIAFVAAPPVDI DGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL IGCACYLGRQWELSYRLGMRPWICVAYSAPLASATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEIESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRQLHFFLAAWPVIGIWFTALGVSTMAFNLNGF NFNQSIIDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD57 (B3GAT1) activation kit by CRISPRa
GA108999 1 Kit

Human CD57 (B3GAT1) activation kit by CRISPRa

Sign In for Pricing
View Details
NT5C2 (NM_001134373) Human Recombinant Protein
TP325961L 1 mg

NT5C2 (NM_001134373) Human Recombinant Protein

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-9E3), CF680R conjugate, 0.1mg/mL
BNC810010-500 1x 500 µL

MART-1 / Melan-A (M2-9E3), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Amplite® Luciferase Reporter Gene Assay Kit *Maximized Luminescence*
12519-AAT 10 Plates

Amplite® Luciferase Reporter Gene Assay Kit *Maximized Luminescence*

Sign In for Pricing
View Details
S100A8 Antibody
KC-3901-01 50 μL

S100A8 Antibody

Sign In for Pricing
View Details
S100A8 Antibody
KC-3901-02 100 µL

S100A8 Antibody

Sign In for Pricing
View Details