Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein

This Recombinant Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

P51764

Expression Region

1-344

Origin

Microcystis aeruginosa

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTLQQRESASLWEQFCQWITSTNNRLYVGWFGVIMIPTLLTATTCFIIAFIAAPPVDI DGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL LGVFCYLGRQWELSFRLGMRPWICVAYSAPVSAATAVFLIYPIGQGSFSDGMPLGISGTF NFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEIESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVIGIWFTAMGVSTMAFNLNGF NFNQSILDSQGRVIGTWVDVLNRAGIGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Fibroblast growth factor receptor 3 (FGFR3) ,partial
RPC21327-01 20 µg

Recombinant Human Fibroblast growth factor receptor 3 (FGFR3) ,partial

Sign In for Pricing
View Details
Recombinant Human Fibroblast growth factor receptor 3 (FGFR3) ,partial
RPC21327-02 100 µg

Recombinant Human Fibroblast growth factor receptor 3 (FGFR3) ,partial

Sign In for Pricing
View Details
Recombinant Human Fibroblast growth factor receptor 3 (FGFR3) ,partial
RPC21327-03 1 mg

Recombinant Human Fibroblast growth factor receptor 3 (FGFR3) ,partial

Sign In for Pricing
View Details
RGD1309540 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV645713 1.0 µg DNA

RGD1309540 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
CD90 Antibody (FITC)
orb435271 25 µg

CD90 Antibody (FITC)

Sign In for Pricing
View Details
USF1 Rabbit pAb
A21998 200 µL

USF1 Rabbit pAb

Sign In for Pricing
View Details