Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermosynechococcus vulcanus Photosystem Q (B) protein

This Recombinant Thermosynechococcus vulcanus Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

P51765

Expression Region

1-344

Origin

Thermosynechococcus vulcanus (Synechococcus vulcanus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDI DGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFL LGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWRVVGVWFAALGISTMAFNLNGF NFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tas2r102 Mouse Gene Knockout Kit (CRISPR)
KN517189 1 Kit

Tas2r102 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TJP1 Human Gene Knockout Kit (CRISPR)
KN416224 1 Kit

TJP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thymocytes Rabbit Polyclonal Antibody
AP31646SU-L 5 mL

Thymocytes Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF488A conjugate, 0.1mg/mL
BNC882103-100 1x 100 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SEC62 Antibody
RC-16606-01 50 μL

Recombinant SEC62 Antibody

Sign In for Pricing
View Details
Recombinant SEC62 Antibody
RC-16606-02 100 µL

Recombinant SEC62 Antibody

Sign In for Pricing
View Details