Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein 2

This Recombinant Photosystem Q (B) protein 2 spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

P0A447

Expression Region

1-344

Origin

Synechococcus elongatus naegeli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTVLQRRQTANLWERFCDWITSTENRLYIGWFGVIMIPTLLAATICFVIAFIAAPPVDI DGIREPVSGSLLYGNNIITAAVVPSSNAIGLHLYPIWDAASLDEWLYNGGPYQLIIFHFL IGIFCYMGREWELSYRLGMRPWIPVAFSAPVAAATAVLLIYPIGQGSFSDGLMLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGALFAAMHGSLVTSSLIRETTETESTNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFAALGISTMAFNLNGF NFNHSVVDAQGNVINTWADIINRANIGIEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLV3-U6-Eif2ak2-shRNA2-EGFP-Puro Plasmid
PVT60530 2 µg

pLV3-U6-Eif2ak2-shRNA2-EGFP-Puro Plasmid

Sign In for Pricing
View Details
ARHGEF16 Antibody (N-term)
orb1432158-01 50 µL

ARHGEF16 Antibody (N-term)

Sign In for Pricing
View Details
ARHGEF16 Antibody (N-term)
orb1432158-02 100 µL

ARHGEF16 Antibody (N-term)

Sign In for Pricing
View Details
ZonuLa occludens protein 3 (TJP3) (NM_014428) Human Recombinant Protein
TP313399L 1 mg

ZonuLa occludens protein 3 (TJP3) (NM_014428) Human Recombinant Protein

Sign In for Pricing
View Details
SCN8A/Nav1.6 Polyclonal Antibody
MBS9238063-01 0.1 mL

SCN8A/Nav1.6 Polyclonal Antibody

Sign In for Pricing
View Details
SCN8A/Nav1.6 Polyclonal Antibody
MBS9238063-02 5x 0.1 mL

SCN8A/Nav1.6 Polyclonal Antibody

Sign In for Pricing
View Details