Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein 2

This Recombinant Photosystem Q (B) protein 2 spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

P0A447

Expression Region

1-344

Origin

Synechococcus elongatus naegeli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTVLQRRQTANLWERFCDWITSTENRLYIGWFGVIMIPTLLAATICFVIAFIAAPPVDI DGIREPVSGSLLYGNNIITAAVVPSSNAIGLHLYPIWDAASLDEWLYNGGPYQLIIFHFL IGIFCYMGREWELSYRLGMRPWIPVAFSAPVAAATAVLLIYPIGQGSFSDGLMLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGALFAAMHGSLVTSSLIRETTETESTNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFAALGISTMAFNLNGF NFNHSVVDAQGNVINTWADIINRANIGIEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIA Rabbit Polyclonal Antibody
E28PT2755 100 µL

MIA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC35G2 (NM_001097600) Human Tagged ORF Clone
RC218185 10 µg

SLC35G2 (NM_001097600) Human Tagged ORF Clone

Sign In for Pricing
View Details
SIM1 sgRNA CRISPR Lentivector (Human) (Target 2)
K2150503 1.0 µg DNA

SIM1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
IL1RAPL1 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb915350 100 µL

IL1RAPL1 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
ELISpot plates, white
3654-WP-10 10 Plates

ELISpot plates, white

Sign In for Pricing
View Details
STIP1 antibody
FNab08323 100 µg

STIP1 antibody

Sign In for Pricing
View Details