Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gossypium barbadense Photosystem Q (B) protein

This Recombinant Gossypium barbadense Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A0ZZ15

Expression Region

1-344

Origin

Gossypium barbadense (Sea-island cotton) (Egyptian cotton)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRLG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNLPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
BNC680218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-100 1x 100 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF568 conjugate, 0.1mg/mL
BNC681917-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (Cocktail PAN-CK), CF543 conjugate, 0.1mg/mL
BNC430999-500 1x 500 µL

Cytokeratin, pan (Cocktail PAN-CK), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/991 + SOX10/1074), CF740 conjugate, 0.1mg/mL
BNC741074-500 1x 500 µL

SOX10 (SOX10/991 + SOX10/1074), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Golgi Complex (371-4), CF640R conjugate, 0.1mg/mL
BNC400102-500 1x 500 µL

Golgi Complex (371-4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details