Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aethionema cordifolium Photosystem Q (B) protein

This Recombinant Aethionema cordifolium Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A4QJ96

Expression Region

1-344

Origin

Aethionema cordifolium (Lebanon stonecress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSSSLHFFLTAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL
BNC400525-100 1x 100 µL

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL
BNC880965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL
BNC881820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-100 1x 100 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-500 1x 500 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF568 conjugate, 0.1mg/mL
BNC682375-100 1x 100 µL

Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details