Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 1

This Recombinant Synechococcus sp. Photosystem Q (B) protein 1 spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 1, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 1, Photosystem II protein D1 1

UniProt

A5GTY4

Expression Region

1-344

Origin

Synechococcus sp. (strain RCC307)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTTIQQRSGASAWQQFCEWVTSTDNRLYVGWFGVLMIPTLLAATTCFIVAFIAAPPVDI DGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPFQLVIFHFL IGIYAYMGREWELSYRLGMRPWICIAYSAPVAAASAVFLVYPFGQGSFSDAMPLGISGTF NYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTESESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGVSTMAFNLNGF NFNQSILDSQGRVLNTWADILNRAGLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDRG4 (BDM1, KIAA1180, Protein NDRG4, Brain Development-related Molecule 1, N-myc Downstream-regulated Gene 4 Protein, Vascular Smooth Muscle Cell-associated Protein 8, SMAP-8, DKFZp686I1615, FLJ30586, FLJ42011, MGC19632) (PE)
MBS6159026-01 0.1 mL

NDRG4 (BDM1, KIAA1180, Protein NDRG4, Brain Development-related Molecule 1, N-myc Downstream-regulated Gene 4 Protein, Vascular Smooth Muscle Cell-associated Protein 8, SMAP-8, DKFZp686I1615, FLJ30586, FLJ42011, MGC19632) (PE)

Sign In for Pricing
View Details
NDRG4 (BDM1, KIAA1180, Protein NDRG4, Brain Development-related Molecule 1, N-myc Downstream-regulated Gene 4 Protein, Vascular Smooth Muscle Cell-associated Protein 8, SMAP-8, DKFZp686I1615, FLJ30586, FLJ42011, MGC19632) (PE)
MBS6159026-02 5x 0.1 mL

NDRG4 (BDM1, KIAA1180, Protein NDRG4, Brain Development-related Molecule 1, N-myc Downstream-regulated Gene 4 Protein, Vascular Smooth Muscle Cell-associated Protein 8, SMAP-8, DKFZp686I1615, FLJ30586, FLJ42011, MGC19632) (PE)

Sign In for Pricing
View Details
SNX12 Human qPCR Template Standard (NM_013346)
HK210115 1 Kit

SNX12 Human qPCR Template Standard (NM_013346)

Sign In for Pricing
View Details
Human Sarcoplasmic Reticulum Histidine-Rich Calcium-Binding Protein (HRC) Protein
abx660066-01 10 µg

Human Sarcoplasmic Reticulum Histidine-Rich Calcium-Binding Protein (HRC) Protein

Sign In for Pricing
View Details
Human Sarcoplasmic Reticulum Histidine-Rich Calcium-Binding Protein (HRC) Protein
abx660066-02 50 µg

Human Sarcoplasmic Reticulum Histidine-Rich Calcium-Binding Protein (HRC) Protein

Sign In for Pricing
View Details
Human Sarcoplasmic Reticulum Histidine-Rich Calcium-Binding Protein (HRC) Protein
abx660066-03 100 µg

Human Sarcoplasmic Reticulum Histidine-Rich Calcium-Binding Protein (HRC) Protein

Sign In for Pricing
View Details