Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 1

This Recombinant Synechococcus sp. Photosystem Q (B) protein 1 spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 1, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 1, Photosystem II protein D1 1

UniProt

A5GIM7

Expression Region

1-344

Origin

Synechococcus sp. (strain WH7803)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTIQQRSGANGWQSFCEWVTSTNNRLYVGWFGVLMIPTLLAATTCFIVAFIAAPPVDI DGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFL IGIFCYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPFGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHMMGVAGVFGGSLFSAMHGSLVTSSLVRETTESESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGVSTMAFNLNGF NFNQSILDGQGRVLNTWADVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLIPR1L1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
21603111 3x 1.0 µg

GLIPR1L1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) Spike RBD (A520S) -His Recombinant Protein
PO55030M2 100 µg

SARS-CoV-2 (2019-nCoV) Spike RBD (A520S) -His Recombinant Protein

Sign In for Pricing
View Details
Npb ORF Vector (Rat) (pORF)
32041016 1.0 µg DNA

Npb ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 Orotate phosphoribosyltransferase (pyrE)
MBS1244110-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O127:H6 Orotate phosphoribosyltransferase (pyrE)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 Orotate phosphoribosyltransferase (pyrE)
MBS1244110-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O127:H6 Orotate phosphoribosyltransferase (pyrE)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 Orotate phosphoribosyltransferase (pyrE)
MBS1244110-03 0.02 mg (Yeast)

Recombinant Escherichia coli O127:H6 Orotate phosphoribosyltransferase (pyrE)

Sign In for Pricing
View Details