Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 1

This Recombinant Synechococcus sp. Photosystem Q (B) protein 1 spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 1, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 1, Photosystem II protein D1 1

UniProt

A5GIM7

Expression Region

1-344

Origin

Synechococcus sp. (strain WH7803)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTIQQRSGANGWQSFCEWVTSTNNRLYVGWFGVLMIPTLLAATTCFIVAFIAAPPVDI DGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFL IGIFCYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPFGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHMMGVAGVFGGSLFSAMHGSLVTSSLVRETTESESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGVSTMAFNLNGF NFNQSILDGQGRVLNTWADVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF274 (Zinc Finger Protein 274, DKFZp686K08243, FLJ37843, HFB101, ZF2, ZKSCAN19) (MaxLight 750) discontinued
253722-ML750 100 µL

ZNF274 (Zinc Finger Protein 274, DKFZp686K08243, FLJ37843, HFB101, ZF2, ZKSCAN19) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS601515 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
OPCA03274-500UG - HA-17 Recombinant Protein
OPCA03274-500UG 500 µg

OPCA03274-500UG - HA-17 Recombinant Protein

Sign In for Pricing
View Details
Deleted In Azoospermia-Like (DAZL) Antibody
abx432592 200 µL

Deleted In Azoospermia-Like (DAZL) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal EDA/Ectodysplasin Antibody (MM0254-3T2) [DyLight 405]
NBP2-12270V 0.1 mL

Mouse Monoclonal EDA/Ectodysplasin Antibody (MM0254-3T2) [DyLight 405]

Sign In for Pricing
View Details
C11orf71 Polyclonal Antibody, FITC Conjugated
bs-9941R-FITC 100 µL

C11orf71 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details