Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 1

This Recombinant Synechococcus sp. Photosystem Q (B) protein 1 spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 1, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 1, Photosystem II protein D1 1

UniProt

A5GIM7

Expression Region

1-344

Origin

Synechococcus sp. (strain WH7803)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTIQQRSGANGWQSFCEWVTSTNNRLYVGWFGVLMIPTLLAATTCFIVAFIAAPPVDI DGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFL IGIFCYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPFGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHMMGVAGVFGGSLFSAMHGSLVTSSLVRETTESESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGVSTMAFNLNGF NFNQSILDGQGRVLNTWADVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT86 (NM_002284) Human Over-expression Lysate
E45H06103-2 20 µg

KRT86 (NM_002284) Human Over-expression Lysate

Sign In for Pricing
View Details
ILVBL Polyclonal Conjugated Antibody
MBS9439438-01 0.1 mL (Biotin)

ILVBL Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
ILVBL Polyclonal Conjugated Antibody
MBS9439438-02 0.1 mL (AF350)

ILVBL Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
ILVBL Polyclonal Conjugated Antibody
MBS9439438-03 0.1 mL (AF405)

ILVBL Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
ILVBL Polyclonal Conjugated Antibody
MBS9439438-04 0.1 mL (AF488)

ILVBL Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
ILVBL Polyclonal Conjugated Antibody
MBS9439438-05 0.1 mL (AF555)

ILVBL Polyclonal Conjugated Antibody

Sign In for Pricing
View Details