Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dioscorea elephantipes Photosystem Q (B) protein

This Recombinant Dioscorea elephantipes Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A6MMI8

Expression Region

1-344

Origin

Dioscorea elephantipes (Elephant's foot)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFLLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF83 Rabbit Polyclonal Antibody
TA365408 100 µL

ZNF83 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chst10 Mouse Gene Knockout Kit (CRISPR)
KN503320 1 Kit

Chst10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SPATA22 Mouse Monoclonal Antibody [Clone ID: OTI1E2]
CF808425 100 µg

SPATA22 Mouse Monoclonal Antibody [Clone ID: OTI1E2]

Sign In for Pricing
View Details
Optineurin Rabbit Polyclonal Antibody
ER2001-02 100 µL

Optineurin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COX4NB (EMC8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D6]
TA507109AM 100 µL

COX4NB (EMC8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D6]

Sign In for Pricing
View Details
CLIP4 Human Gene Knockout Kit (CRISPR)
KN423379 1 Kit

CLIP4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details