Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dioscorea elephantipes Photosystem Q (B) protein

This Recombinant Dioscorea elephantipes Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A6MMI8

Expression Region

1-344

Origin

Dioscorea elephantipes (Elephant's foot)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFLLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLAMF7 Human Gene Knockout Kit (CRISPR)
KN220985LP 1 Kit

SLAMF7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human DR3/TNFRSF25 Recombinant Rabbit monoclonal Antibody
HA723869 100 µL

Human DR3/TNFRSF25 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Thyroid gland
CB506265 1 Block

Frozen Tissue Blocks, Thyroid gland

Sign In for Pricing
View Details
Human SDCCAG10 (CWC27) activation kit by CRISPRa
GA107004 1 Kit

Human SDCCAG10 (CWC27) activation kit by CRISPRa

Sign In for Pricing
View Details
CD127 / IL7R (Marker of T-Reg Cells) (IL7R/2751), CF640R conjugate, 0.1mg/mL
BNC402751-500 1x 500 µL

CD127 / IL7R (Marker of T-Reg Cells) (IL7R/2751), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gasdermin D (N terminal) Recombinant Rabbit monoclonal Antibody
HA723254 100 µL

Gasdermin D (N terminal) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details