Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buxus microphylla Photosystem Q (B) protein

This Recombinant Buxus microphylla Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A6MM16

Expression Region

1-344

Origin

Buxus microphylla (Little leaf boxwood) (Japanese boxwood)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-7031-3p antagomir
HY-RI03801A-01 5 nmol

Mmu-miR-7031-3p antagomir

Sign In for Pricing
View Details
Mmu-miR-7031-3p antagomir
HY-RI03801A-02 20 nmol

Mmu-miR-7031-3p antagomir

Sign In for Pricing
View Details
Porcine Cancer/testis antigen 47B (CT47B1) ELISA kit
GTR10442628 96 Well

Porcine Cancer/testis antigen 47B (CT47B1) ELISA kit

Sign In for Pricing
View Details
Anti-Fibroblast activation -α (Rabbit, Monoclonal)
A113126 100 µL

Anti-Fibroblast activation -α (Rabbit, Monoclonal)

Sign In for Pricing
View Details
STAT1 Human shRNA Plasmid Kit (Locus ID 6772)
TL301349 1 Kit

STAT1 Human shRNA Plasmid Kit (Locus ID 6772)

Sign In for Pricing
View Details
At4g02110 Antibody
orb796447 2 mg

At4g02110 Antibody

Sign In for Pricing
View Details