Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buxus microphylla Photosystem Q (B) protein

This Recombinant Buxus microphylla Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A6MM16

Expression Region

1-344

Origin

Buxus microphylla (Little leaf boxwood) (Japanese boxwood)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PACSIN1, NT (Protein Kinase C And Casein Kinase Substrate In Neurons Protein 1, KIAA1379) (FITC)
MBS6491661-01 0.2 mL

PACSIN1, NT (Protein Kinase C And Casein Kinase Substrate In Neurons Protein 1, KIAA1379) (FITC)

Sign In for Pricing
View Details
PACSIN1, NT (Protein Kinase C And Casein Kinase Substrate In Neurons Protein 1, KIAA1379) (FITC)
MBS6491661-02 5x 0.2 mL

PACSIN1, NT (Protein Kinase C And Casein Kinase Substrate In Neurons Protein 1, KIAA1379) (FITC)

Sign In for Pricing
View Details
Human IL18BP Protein, Fc Tag
KMPH6003-01 100 µg

Human IL18BP Protein, Fc Tag

Sign In for Pricing
View Details
Human IL18BP Protein, Fc Tag
KMPH6003-02 1 mg

Human IL18BP Protein, Fc Tag

Sign In for Pricing
View Details
HSF1 Polyclonal Antibody
RA26073-01 50 µL

HSF1 Polyclonal Antibody

Sign In for Pricing
View Details
HSF1 Polyclonal Antibody
RA26073-02 100 µL

HSF1 Polyclonal Antibody

Sign In for Pricing
View Details