Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 3

This Recombinant Synechococcus sp. Photosystem Q (B) protein 3 spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 3, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 3, Photosystem II protein D1 3

UniProt

B1XIP3

Expression Region

1-344

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTLLQQQGSANLWERFCQWVTSTENRFYVGWFGVLMIPTLLTATICFILAFVAAPPVDI DGIREPVAGSLLYGNNIITAAVVPSSNAIGLHFYPIWDAANLDEWLYNGGPYQLIVFHFL LGIFSYMGREWELSYRLGMRPWIAVAYSAPVAAATAVLLVYSIGQGSFSDGLPLGISGTF NFMFVLQAEHNVLMHPFHMLGVAGVFGGALFSAMHGSLVTSSLIRETTETESQNSGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLAAWPVIGIWFASLAVACFAFNLNGF NFNQSLLDSQGRVINTWADILNRANLGIEAMHERNVHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human GOT1 (Glutamate Oxaloacetate Transaminase 1) ELISA Kit
E-UNEL-H0239-01 5x 96 Tests

Uncoated Human GOT1 (Glutamate Oxaloacetate Transaminase 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human GOT1 (Glutamate Oxaloacetate Transaminase 1) ELISA Kit
E-UNEL-H0239-02 15x 96 Tests

Uncoated Human GOT1 (Glutamate Oxaloacetate Transaminase 1) ELISA Kit

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF740 conjugate, 0.1mg/mL
BNC742076-100 1x 100 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BNP (NPPB) (NM_002521) Human Over-expression Lysate
LY400900 100 µg

BNP (NPPB) (NM_002521) Human Over-expression Lysate

Sign In for Pricing
View Details
Moroxydine-d8 Hydrochloride
TRC-M651752-5MG 5 mg

Moroxydine-d8 Hydrochloride

Sign In for Pricing
View Details
Prolactin Antibody (Biotin)
KB-3684-01 50 μL

Prolactin Antibody (Biotin)

Sign In for Pricing
View Details