Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 3

This Recombinant Synechococcus sp. Photosystem Q (B) protein 3 spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 3, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 3, Photosystem II protein D1 3

UniProt

B1XIP3

Expression Region

1-344

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTLLQQQGSANLWERFCQWVTSTENRFYVGWFGVLMIPTLLTATICFILAFVAAPPVDI DGIREPVAGSLLYGNNIITAAVVPSSNAIGLHFYPIWDAANLDEWLYNGGPYQLIVFHFL LGIFSYMGREWELSYRLGMRPWIAVAYSAPVAAATAVLLVYSIGQGSFSDGLPLGISGTF NFMFVLQAEHNVLMHPFHMLGVAGVFGGALFSAMHGSLVTSSLIRETTETESQNSGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLAAWPVIGIWFASLAVACFAFNLNGF NFNQSLLDSQGRVINTWADILNRANLGIEAMHERNVHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEACAM19 (NM_001127893) Human Over-expression Lysate
LC426880 20 µg

CEACAM19 (NM_001127893) Human Over-expression Lysate

Sign In for Pricing
View Details
Erythropoietin (EPO) (Marker of Placentation Disorders) (EPO/3793R), CF647 conjugate, 0.1mg/mL
BNC473793-500 1x 500 µL

Erythropoietin (EPO) (Marker of Placentation Disorders) (EPO/3793R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOK3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H9]
TA813133BM 100 µL

DOK3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H9]

Sign In for Pricing
View Details
Foxp3 Mouse Monoclonal Antibody [Clone ID: 3G3]
AM12131PU-N 100 µg

Foxp3 Mouse Monoclonal Antibody [Clone ID: 3G3]

Sign In for Pricing
View Details
GSTA6P Mouse Monoclonal Antibody [Clone ID: 3D10]
AM06391SU-N 100 µL

GSTA6P Mouse Monoclonal Antibody [Clone ID: 3D10]

Sign In for Pricing
View Details
Recombinant Human NRXN3 Protein (Fc Tag)
PKSH030985 100 µg

Recombinant Human NRXN3 Protein (Fc Tag)

Sign In for Pricing
View Details