Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 3

This Recombinant Synechococcus sp. Photosystem Q (B) protein 3 spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 3, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 3, Photosystem II protein D1 3

UniProt

B1XIP3

Expression Region

1-344

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTLLQQQGSANLWERFCQWVTSTENRFYVGWFGVLMIPTLLTATICFILAFVAAPPVDI DGIREPVAGSLLYGNNIITAAVVPSSNAIGLHFYPIWDAANLDEWLYNGGPYQLIVFHFL LGIFSYMGREWELSYRLGMRPWIAVAYSAPVAAATAVLLVYSIGQGSFSDGLPLGISGTF NFMFVLQAEHNVLMHPFHMLGVAGVFGGALFSAMHGSLVTSSLIRETTETESQNSGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLAAWPVIGIWFASLAVACFAFNLNGF NFNQSLLDSQGRVINTWADILNRANLGIEAMHERNVHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A6]
TA800037BM 100 µL

USP12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A6]

Sign In for Pricing
View Details
Human PGRP1B (PGLYRP4) activation kit by CRISPRa
GA111381 1 Kit

Human PGRP1B (PGLYRP4) activation kit by CRISPRa

Sign In for Pricing
View Details
BRCA1 (Breast Marker) (BRCA1/1472), CF640R conjugate, 0.1mg/mL
BNC401472-100 1x 100 µL

BRCA1 (Breast Marker) (BRCA1/1472), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody [Clone ID: SPM565]
AM50149PU-T 20 µg

Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody [Clone ID: SPM565]

Sign In for Pricing
View Details
LMO2 Rabbit Polyclonal Antibody
TA378089 100 µL

LMO2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS622478 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details