Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 1

This Recombinant Synechococcus sp. Photosystem Q (B) protein 1 spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 1, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 1, Photosystem II protein D1 1

UniProt

B1XM24

Expression Region

1-344

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTLQQRGSASLWEKFCQWITSTENRIYVGWFGVLMIPTLLTATTCFIIAFIAAPPVDI DGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL IGVFCYMGREWELSYRLGMRPWICVAFSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVVGIWFTALGVSTMAFNLNGF NFNQSILDSQGRVINTWADILNRANLGFEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL24 Mouse Monoclonal Antibody [Clone ID: OTI5C8]
TA809467S 30 µL

IL24 Mouse Monoclonal Antibody [Clone ID: OTI5C8]

Sign In for Pricing
View Details
Recombinant Mycoplasma pulmonis Ribonuclease R (rnr), partial
MBS1321624 Inquire

Recombinant Mycoplasma pulmonis Ribonuclease R (rnr), partial

Sign In for Pricing
View Details
TOLLIP (3N3) Mouse Monoclonal antibody
E28PE4173 100 µL

TOLLIP (3N3) Mouse Monoclonal antibody

Sign In for Pricing
View Details
NOSTRIN ORF Vector (Human) (pORF)
ORF007162 1.0 µg DNA

NOSTRIN ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
RSK1 p90 Blocking Peptide
MBS9616766-01 1 mg

RSK1 p90 Blocking Peptide

Sign In for Pricing
View Details
RSK1 p90 Blocking Peptide
MBS9616766-02 5x 1 mg

RSK1 p90 Blocking Peptide

Sign In for Pricing
View Details