Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 1

This Recombinant Synechococcus sp. Photosystem Q (B) protein 1 spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 1, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 1, Photosystem II protein D1 1

UniProt

B1XM24

Expression Region

1-344

Origin

Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTLQQRGSASLWEKFCQWITSTENRIYVGWFGVLMIPTLLTATTCFIIAFIAAPPVDI DGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL IGVFCYMGREWELSYRLGMRPWICVAFSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVVGIWFTALGVSTMAFNLNGF NFNQSILDSQGRVINTWADILNRANLGFEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-548ao-3p miRNA Mimic
MBS8299791-01 5 nmol

hsa-miR-548ao-3p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-548ao-3p miRNA Mimic
MBS8299791-02 10 nmol

hsa-miR-548ao-3p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-548ao-3p miRNA Mimic
MBS8299791-03 5x 10 nmol

hsa-miR-548ao-3p miRNA Mimic

Sign In for Pricing
View Details
Mcm8 (BC046780) Mouse Tagged Lenti ORF Clone
MR210873L4 10 µg

Mcm8 (BC046780) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Dengue Virus Dengue-HRP Protein, Untagged, E.coli-1mg
QP11655-1mg 1mg

Recombinant Dengue Virus Dengue-HRP Protein, Untagged, E.coli-1mg

Sign In for Pricing
View Details
Rat Protein Kinase C Delta (PKCd) ELISA Kit
DLR-PKCd-Ra-48T 48 Tests

Rat Protein Kinase C Delta (PKCd) ELISA Kit

Sign In for Pricing
View Details