Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vitis vinifera Photosystem Q (B) protein (psbA)

This Recombinant Vitis vinifera Photosystem Q (B) protein (psbA) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q0ZJ40

Expression Region

1-344

Origin

Vitis vinifera (Grape)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAAAAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magrolimab Biosimilar - Research Grade
ICH5036-100mg 100 mg

Magrolimab Biosimilar - Research Grade

Sign In for Pricing
View Details
Recombinant Mouse IL-23A Protein (Fc Tag)
PDMM100097-01 20 µg

Recombinant Mouse IL-23A Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-23A Protein (Fc Tag)
PDMM100097-02 100 µg

Recombinant Mouse IL-23A Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-23A Protein (Fc Tag)
PDMM100097-03 500 µg

Recombinant Mouse IL-23A Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-23A Protein (Fc Tag)
PDMM100097-04 1 mg

Recombinant Mouse IL-23A Protein (Fc Tag)

Sign In for Pricing
View Details
Beta crystallin S (CRYGS) (NM_017541) Human Recombinant Protein
TP310159 20 µg

Beta crystallin S (CRYGS) (NM_017541) Human Recombinant Protein

Sign In for Pricing
View Details