Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein (psbA)

This Recombinant Photosystem Q (B) protein (psbA) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q1XDS5

Expression Region

1-344

Origin

Porphyra yezoensis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATLQRRESASLWERFCSWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFVAAPPVDI DGIREPVAGSLLYGNNIISGAVIPSSAAIGIHFYPIWEAASLDEWLYNGGPYQLVVLHFL TGVACYIGREWELSYRLGMRPWISVAFTAPVAAAAAVFLVYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHQLGVAGVFGGSLFSAMHGSLVTSSLIRETSENESANYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGLWPVVGIWLTALSVSTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Zea mays (Maize) NIP3-1 Polyclonal Antibody
MBS9006520 Inquire

Rabbit anti-Zea mays (Maize) NIP3-1 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human LCN6 shRNA (UAS) - Lentiviral human LCN6 shRNA (UAS, GFP) plasmid
GTR15092134 1 Vial

Lentiviral human LCN6 shRNA (UAS) - Lentiviral human LCN6 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-conjugating enzyme E2 R2/UBE2R2
BP3504-50ug 50 µg

Recombinant Human Ubiquitin-conjugating enzyme E2 R2/UBE2R2

Sign In for Pricing
View Details
UNC-80 Lentiviral Activation Particles (h)
sc-406472-LAC 200 µL

UNC-80 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
HIPK1, CT (HIPK1, KIAA0630, MYAK, NBAK2, Homeodomain-interacting protein kinase 1, Nuclear body-associated kinase 2) (Biotin) discontinued
036563-Biotin 200 µL

HIPK1, CT (HIPK1, KIAA0630, MYAK, NBAK2, Homeodomain-interacting protein kinase 1, Nuclear body-associated kinase 2) (Biotin) discontinued

Sign In for Pricing
View Details
Recombinant Oedogonium cardiacum DNA-directed RNA polymerase subunit beta' (rpoC1), partial
MBS1215236 Inquire

Recombinant Oedogonium cardiacum DNA-directed RNA polymerase subunit beta' (rpoC1), partial

Sign In for Pricing
View Details