Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

Q2JP67

Expression Region

1-344

Origin

Synechococcus sp. (strain JA-2-3B'a (2-13) ) (Cyanobacteria bacterium Yellowstone B-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTVIQRRSTSNVWEQFCEWVTSTDNRLYIGWFGVLMIPTLLTATTCFIIAFIGAPPVDI DGIREPVSGSLLYGNNIISGAVVPSSAAIGLHFYPIWEAASLDEWLYNGGPYQLIVLHFL IGVFCYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHQLGVAGVFGGALFSAMHGSLVTSSLIRETSEEESQNLGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISIMAFNLNGF NFNQSIVDSNGRVVGTWADVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (TRP/816), CF405S conjugate, 0.1mg/mL
BNC040816-500 1x 500 µL

P53 (TRP/816), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Timp3 (NM_011595) Mouse Tagged ORF Clone
MG202295 10 µg

Timp3 (NM_011595) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR561112 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
N,N’-Dicyclohexylcarbodiimide Pentachlorophenol Complex
TRC-D439100-10G 10 g

N,N’-Dicyclohexylcarbodiimide Pentachlorophenol Complex

Sign In for Pricing
View Details
Muscarinic Acetylcholine Receptor M3 (CHRM3) (NM_000740) Human Over-expression Lysate
LY400244 100 µg

Muscarinic Acetylcholine Receptor M3 (CHRM3) (NM_000740) Human Over-expression Lysate

Sign In for Pricing
View Details
CD99 (MIC2/877), CF594 conjugate, 0.1mg/mL
BNC940877-100 1x 100 µL

CD99 (MIC2/877), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details