Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

Q2JP67

Expression Region

1-344

Origin

Synechococcus sp. (strain JA-2-3B'a (2-13) ) (Cyanobacteria bacterium Yellowstone B-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTVIQRRSTSNVWEQFCEWVTSTDNRLYIGWFGVLMIPTLLTATTCFIIAFIGAPPVDI DGIREPVSGSLLYGNNIISGAVVPSSAAIGLHFYPIWEAASLDEWLYNGGPYQLIVLHFL IGVFCYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHQLGVAGVFGGALFSAMHGSLVTSSLIRETSEEESQNLGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISIMAFNLNGF NFNQSIVDSNGRVVGTWADVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM164B (ZC2HC1B) (NM_001013623) Human Over-expression Lysate
LY425352 100 µg

FAM164B (ZC2HC1B) (NM_001013623) Human Over-expression Lysate

Sign In for Pricing
View Details
Human LARGE2 activation kit by CRISPRa
GA114708 1 Kit

Human LARGE2 activation kit by CRISPRa

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sophora japonica (Pagoda Tree) -SJA-, 1mL 15nm
GP-2901-15 1 mL

Colloidal Gold Conjugated Sophora japonica (Pagoda Tree) -SJA-, 1mL 15nm

Sign In for Pricing
View Details
Prolactin Receptor (hPRL Receptor) (rPRLR/742), CF640R conjugate, 0.1mg/mL
BNC403784-100 1x 100 µL

Prolactin Receptor (hPRL Receptor) (rPRLR/742), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAF1 pSer338 Rabbit Polyclonal Antibody
AP12801PU-N 400 µL

RAF1 pSer338 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF4E Antibody (Biotin)
KB-7904-01 50 μL

EIF4E Antibody (Biotin)

Sign In for Pricing
View Details