Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

Q2JP67

Expression Region

1-344

Origin

Synechococcus sp. (strain JA-2-3B'a (2-13) ) (Cyanobacteria bacterium Yellowstone B-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTVIQRRSTSNVWEQFCEWVTSTDNRLYIGWFGVLMIPTLLTATTCFIIAFIGAPPVDI DGIREPVSGSLLYGNNIISGAVVPSSAAIGLHFYPIWEAASLDEWLYNGGPYQLIVLHFL IGVFCYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHQLGVAGVFGGALFSAMHGSLVTSSLIRETSEEESQNLGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISIMAFNLNGF NFNQSIVDSNGRVVGTWADVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSH Receptor (TSHR) (NM_000369) Human Over-expression Lysate
LY400133 100 µg

TSH Receptor (TSHR) (NM_000369) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IgG (Fcγ fragment specific), AlpSdAbs® VHH (Biotin)
HA710184 100 µg

Human IgG (Fcγ fragment specific), AlpSdAbs® VHH (Biotin)

Sign In for Pricing
View Details
B Raf (BRAF) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D4]
TA500852AM 100 µL

B Raf (BRAF) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D4]

Sign In for Pricing
View Details
DLL3 Human Gene Knockout Kit (CRISPR)
KN400005 1 Kit

DLL3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CNOT7, C-His Tag
HA210537-01 20 µg

Human CNOT7, C-His Tag

Sign In for Pricing
View Details
Human CNOT7, C-His Tag
HA210537-02 50 µg

Human CNOT7, C-His Tag

Sign In for Pricing
View Details