Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 1 (psbA1)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 1 (psbA1) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 1, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 1, Photosystem II protein D1 1

UniProt

Q2JTJ2

Expression Region

1-344

Origin

Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTVIQRRSTSNVWEQFCEWVTSTDNRLYIGWFGVLMIPTLLTATTCFIIAFIGAPPVDI DGIREPVSGSLLYGNNIITGAVVPSSAAIGLHFYPIWEAASLDEWLYNGGPYQLIVLHFL IGVFCYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHQLGVAGVFGGALFSAMHGSLVTSSLIRETSEEESQNLGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISIMAFNLNGF NFNQSIVDSNGRVVGTWADVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUCY1A2 Antibody - N-terminal region
ARP70517_P050-25UL 25 µL

GUCY1A2 Antibody - N-terminal region

Sign In for Pricing
View Details
Rabbit Anti-NiV F F2 Monoclonal Antibody, clone 11F10
CABT-NS1199 200 μg

Rabbit Anti-NiV F F2 Monoclonal Antibody, clone 11F10

Sign In for Pricing
View Details
Human Gliadin IgA ELISA Kit
EIA05729h 1 Kit

Human Gliadin IgA ELISA Kit

Sign In for Pricing
View Details
41BB Ligand antibody (PE)
MBS834226-01 0.05 mg

41BB Ligand antibody (PE)

Sign In for Pricing
View Details
41BB Ligand antibody (PE)
MBS834226-02 0.1 mg

41BB Ligand antibody (PE)

Sign In for Pricing
View Details
41BB Ligand antibody (PE)
MBS834226-03 5x 0.1 mg

41BB Ligand antibody (PE)

Sign In for Pricing
View Details