Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 1 (psbA1)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 1 (psbA1) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 1, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 1, Photosystem II protein D1 1

UniProt

Q2JTJ2

Expression Region

1-344

Origin

Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTVIQRRSTSNVWEQFCEWVTSTDNRLYIGWFGVLMIPTLLTATTCFIIAFIGAPPVDI DGIREPVSGSLLYGNNIITGAVVPSSAAIGLHFYPIWEAASLDEWLYNGGPYQLIVLHFL IGVFCYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHQLGVAGVFGGALFSAMHGSLVTSSLIRETSEEESQNLGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISIMAFNLNGF NFNQSIVDSNGRVVGTWADVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDC (NM_006600) Human 3' UTR Clone
SC203677 10 µg

NUDC (NM_006600) Human 3' UTR Clone

Sign In for Pricing
View Details
MR-1 NC EU SPC-SpillContnmt
196271 Piece of 1 Piece(s)

MR-1 NC EU SPC-SpillContnmt

Sign In for Pricing
View Details
Rat Ki-67 Protein (Ki67P) ELISA Kit
RDR-Ki67P-Ra-96Tests 96 Tests

Rat Ki-67 Protein (Ki67P) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Human Akt1 Polyclonal Antibody
PA84922HU-01 50 µg

Rabbit Anti-Human Akt1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Akt1 Polyclonal Antibody
PA84922HU-02 100 µg

Rabbit Anti-Human Akt1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Akt1 Polyclonal Antibody
PA84922HU-03 500 µg

Rabbit Anti-Human Akt1 Polyclonal Antibody

Sign In for Pricing
View Details