Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 3 (psbA3)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 3 (psbA3) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 3, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 3, Photosystem II protein D1 3

UniProt

Q2JTM8

Expression Region

1-344

Origin

Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTVIQRRSTSNVWEQFCEWVTSTDNRLYIGWFGVLMIPTLLTATTCFIIAFIGAPPVDI DGIREPVSGSLLYGNNIITGAVVPSSAAIGLHFYPIWEAASLDEWLYNGGPYQLIVLHFL IGVFCYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHQLGVAGVFGGALFSAMHGSLVTSSLIRETSEEESQNLGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISIMAFNLNGF NFNQSIVDSNGRVVGTWADVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WFDC8 activation kit by CRISPRa
GA113987 1 Kit

Human WFDC8 activation kit by CRISPRa

Sign In for Pricing
View Details
FLRT3 (NM_198391) Human Recombinant Protein
TP305052L 1 mg

FLRT3 (NM_198391) Human Recombinant Protein

Sign In for Pricing
View Details
Human ACE2 Recombinant Rabbit monoclonal Antibody
HA723905 100 µL

Human ACE2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
3a-Phenylacetoxy Tropane
TRC-P306100-50MG 50 mg

3a-Phenylacetoxy Tropane

Sign In for Pricing
View Details
URP2 (FERMT3) (NM_031471) Human Over-expression Lysate
LC403121 20 µg

URP2 (FERMT3) (NM_031471) Human Over-expression Lysate

Sign In for Pricing
View Details
TRHDE Human Gene Knockout Kit (CRISPR)
KN424738 1 Kit

TRHDE Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details