Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phalaenopsis aphrodite subsp. formosana Photosystem Q (B) protein (psbA)

This Recombinant Phalaenopsis aphrodite subsp. formosana Photosystem Q (B) protein (psbA) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q3BAR4

Expression Region

1-344

Origin

Phalaenopsis aphrodite subsp. formosana (Moth orchid)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-500 1x 500 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-500 1x 500 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL
BNC880679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF405S conjugate, 0.1mg/mL
BNC040914-100 1x 100 µL

NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), 1mg/mL
BNUM0745-50 1x 50 µL

CD45 / LCA (2B11 + PD7/26), 1mg/mL

Sign In for Pricing
View Details
BRCA1 (Breast Marker) (BRCA1/1398), CF740 conjugate, 0.1mg/mL
BNC741398-500 1x 500 µL

BRCA1 (Breast Marker) (BRCA1/1398), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details