Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anabaena variabilis Photosystem Q (B) protein 2 (psbA2)

This Recombinant Anabaena variabilis Photosystem Q (B) protein 2 (psbA2) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

Q3MAB1

Expression Region

1-344

Origin

Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATLQQRKSANVWEQFCEWITSTNNRLYIGWFGVLMIPTLLAATTCFIIAFIAAPPVDI DGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL TGVFCYLGREWELSYRLGMRPWICLAFSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTENESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRQLHFFLAAWPVIGIWFTALGVSTMAFNLNGF NFNQSIIDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG4A Rabbit Polyclonal Antibody (FITC)
orb2596233 100 µg

ATG4A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
YKL-06-061 25mg
A18836-25 25 mg

YKL-06-061 25mg

Sign In for Pricing
View Details
GNG3 (Guanine Nucleotide-binding Protein G(I)/G(S)/G(O) Subunit gamma-3, GNGT3) (Biotin)
MBS6142120-01 0.1 mL

GNG3 (Guanine Nucleotide-binding Protein G(I)/G(S)/G(O) Subunit gamma-3, GNGT3) (Biotin)

Sign In for Pricing
View Details
GNG3 (Guanine Nucleotide-binding Protein G(I)/G(S)/G(O) Subunit gamma-3, GNGT3) (Biotin)
MBS6142120-02 5x 0.1 mL

GNG3 (Guanine Nucleotide-binding Protein G(I)/G(S)/G(O) Subunit gamma-3, GNGT3) (Biotin)

Sign In for Pricing
View Details
Anti-HIBADH antibody
STJ93496 200 µl

Anti-HIBADH antibody

Sign In for Pricing
View Details
Mouse Monoclonal FABP2/I-FABP Antibody (CPTC-FABP2-3) [PerCP]
NBP3-08950PCP 0.1 mL

Mouse Monoclonal FABP2/I-FABP Antibody (CPTC-FABP2-3) [PerCP]

Sign In for Pricing
View Details