Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anabaena variabilis Photosystem Q (B) protein 2 (psbA2)

This Recombinant Anabaena variabilis Photosystem Q (B) protein 2 (psbA2) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

Q3MAB1

Expression Region

1-344

Origin

Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATLQQRKSANVWEQFCEWITSTNNRLYIGWFGVLMIPTLLAATTCFIIAFIAAPPVDI DGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL TGVFCYLGREWELSYRLGMRPWICLAFSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTENESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRQLHFFLAAWPVIGIWFTALGVSTMAFNLNGF NFNQSIIDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gltpd1 AAV siRNA Pooled Vector
21639164 1.0 µg

Gltpd1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse Dis3l2 activation kit by CRISPRa
GA212887 1 Kit

Mouse Dis3l2 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Monoclonal 14-3-3 sigma/Stratifin Antibody (CPTC-SFN-2) [DyLight 488]
NBP3-08214G 100 µL

Mouse Monoclonal 14-3-3 sigma/Stratifin Antibody (CPTC-SFN-2) [DyLight 488]

Sign In for Pricing
View Details
Phenol Std 24-Dinitrophenol 2000ug/mL in MeOH - 1ML
REPHE106 1 mL

Phenol Std 24-Dinitrophenol 2000ug/mL in MeOH - 1ML

Sign In for Pricing
View Details
Phospho-NR3C1 (S226) Antibody
MBS7118330-01 0.05 mg

Phospho-NR3C1 (S226) Antibody

Sign In for Pricing
View Details
Phospho-NR3C1 (S226) Antibody
MBS7118330-02 0.1 mg

Phospho-NR3C1 (S226) Antibody

Sign In for Pricing
View Details