Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 1 (psbA1)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 1 (psbA1) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 1, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 1, Photosystem II protein D1 1

UniProt

Q3AM89

Expression Region

1-344

Origin

Synechococcus sp. (strain CC9605)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTLQQRSGASSWQAFCEWVTSTNNRLYVGWFGVLMIPTLLAATICFVIAFVAAPPVDI DGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPFQLVVFHFL IGIYAYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPFGQGSFSDAMPLGISGTF NYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTESESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGVSTMAFNLNGF NFNQSILDGQGRVLNTWADVLNRAGLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS707494 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Sod2 Mouse Gene Knockout Kit (CRISPR)
KN516462 1 Kit

Sod2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C11orf49 Rabbit Polyclonal Antibody
TA370107 100 µL

C11orf49 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ptpn11 Mouse Gene Knockout Kit (CRISPR)
KN314207RB 1 Kit

Ptpn11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
USP15 (C-term) Goat Polyclonal Antibody
AP31856PU-N 100 µg

USP15 (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
TLR2 Human Gene Knockout Kit (CRISPR)
KN207597LP 1 Kit

TLR2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details