Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein (psbA)

This Recombinant Photosystem Q (B) protein (psbA) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q4G3F2

Expression Region

1-344

Origin

Emiliania huxleyi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTLERRESASFWEQFCAWITSTENRLYIGWFGCLMFPTLLSAISAYIIAFIAAPPVDI DGIREPVAGSLLYGNNIISGAVVPSSNAIGVHFYPIWEAASIDEWLYNGGTYQLVVLHFF IGVCAYIGREWELSYRLGMRPWICVAFSAPVAAAAAVFVIYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLGAWPVVGIWFTAMGVATMAFNLNGF NFNQSVVDSQGRVINTWADILNRSNLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCRTR1 Antibody, Biotin conjugated
CSB-PA010231HD01HU-01 50 μL

HCRTR1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
HCRTR1 Antibody, Biotin conjugated
CSB-PA010231HD01HU-02 100 µL

HCRTR1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Cas9-GFP Overexpression A-549 Stable Cell Line
ARG0061 1 Million

Cas9-GFP Overexpression A-549 Stable Cell Line

Sign In for Pricing
View Details
Mouse anti mCherry-Tag mAb
E45M22041N 50 ul

Mouse anti mCherry-Tag mAb

Sign In for Pricing
View Details
Human TIMM44 Pre-designed siRNA Set A
SI016658A 1 Each

Human TIMM44 Pre-designed siRNA Set A

Sign In for Pricing
View Details
OCTN1 Blocking Peptide
abx161187-01 1 mg

OCTN1 Blocking Peptide

Sign In for Pricing
View Details