Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

Q5N4D2

Expression Region

1-344

Origin

Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTALQRRESASLWQQFCEWVTSTDNRLYVGWFGVLMILTLLTATICFIVAFIAAPPVDI DGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFL IGVFCYMGREWELSYRLGMRPWICVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTSLGISTMAFNLNGF NFNQSVLDSQGRVINTWADVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTA1 Adenovirus (Mouse)
11229054 1.0 mL

ACTA1 Adenovirus (Mouse)

Sign In for Pricing
View Details
NAT1 (NM_001160174) Human Over-expression Lysate
LH00845V 100 µg

NAT1 (NM_001160174) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-ATP4B Antibody Picoband®, PE Conjugate
A08719-2-PE 100 µg/Vial

Anti-ATP4B Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
SB 297006
MBS5750745 Inquire

SB 297006

Sign In for Pricing
View Details
ZFP42 Protein Lysate (Mouse) with C-HA Tag
50965034 100 µg

ZFP42 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Growth Hormone/GH1 Rabbit Polyclonal Antibody
orb99172 100 µg

Growth Hormone/GH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details