Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2)

This Recombinant Synechococcus sp. Photosystem Q (B) protein 2 (psbA2) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

Q5N4D2

Expression Region

1-344

Origin

Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTALQRRESASLWQQFCEWVTSTDNRLYVGWFGVLMILTLLTATICFIVAFIAAPPVDI DGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFL IGVFCYMGREWELSYRLGMRPWICVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTSLGISTMAFNLNGF NFNQSVLDSQGRVINTWADVLNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOL10 Blocking Peptide
MBS9624436-01 1 mg

NOL10 Blocking Peptide

Sign In for Pricing
View Details
NOL10 Blocking Peptide
MBS9624436-02 5x 1 mg

NOL10 Blocking Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal Bub1 Antibody [Alexa Fluor 532]
NBP1-76797AF532 0.1 mL

Rabbit Polyclonal Bub1 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
CPM Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV656053 1.0 µg DNA

CPM Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
IFNAR1 polyclonal antibody
BS80214-01 50 µL

IFNAR1 polyclonal antibody

Sign In for Pricing
View Details
IFNAR1 polyclonal antibody
BS80214-02 100 µL

IFNAR1 polyclonal antibody

Sign In for Pricing
View Details