Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Panax ginseng Photosystem Q (B) protein (psbA)

This Recombinant Panax ginseng Photosystem Q (B) protein (psbA) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q68S26

Expression Region

1-344

Origin

Panax ginseng (Korean ginseng)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAAAAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PCSK9, C-His Tag
HA210991-01 Inquire

Human PCSK9, C-His Tag

Sign In for Pricing
View Details
Human PCSK9, C-His Tag
HA210991-02 50 µg

Human PCSK9, C-His Tag

Sign In for Pricing
View Details
Human PCSK9, C-His Tag
HA210991-03 100 µg

Human PCSK9, C-His Tag

Sign In for Pricing
View Details
3-Phenylglutaric Acid
TRC-P327505-1G 1 g

3-Phenylglutaric Acid

Sign In for Pricing
View Details
Human TTLL7 activation kit by CRISPRa
GA112591 1 Kit

Human TTLL7 activation kit by CRISPRa

Sign In for Pricing
View Details
4-Chlorophenyl Benzoate
TRC-C375180-2.5G 2.5 g

4-Chlorophenyl Benzoate

Sign In for Pricing
View Details