Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gloeobacter violaceus Photosystem Q (B) protein 2 (psbA2)

This Recombinant Gloeobacter violaceus Photosystem Q (B) protein 2 (psbA2) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

Q7NJX5

Expression Region

1-344

Origin

Gloeobacter violaceus (strain PCC 7421)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATILRRRSLGNPWEQFANWITSTDNRFYIGWFGVLMVPTLLSATICFVVAFIAAPPVDM DGIREPISGSLLYGNNIITGAVIPSSNAIGLHFYPIWEAASMDEWLYNGGPYQLVVFHFL IGIFAYLGREWEFSYRLGLRPWICVAYSAPVAAATAVFLIYPMGQGSFSDGMSLGISGTF NFMFIFQAEHNILNHPLHMFGVAGVFGGSLFAAMHGSLVTSSLIKATSYEESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFTNSRSLHFFLAAWPVIGIWLTSLGICVMGFNLNGF NFNASITDNQGRTIYTWADIVNRANLGIEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stromal Cell Derived Factor 1alpha (SDF1 alpha, SDF1a, SDF-1a, Chemokine (C-X-C Motif) Ligand 12, CXCL12, hIRH, Pre-B cell Growth-stimulating Factor, PBSF, SCYB12, TLSF-a, TPAR1) (AP) discontinued
S7975-15-AP 100 µL

Stromal Cell Derived Factor 1alpha (SDF1 alpha, SDF1a, SDF-1a, Chemokine (C-X-C Motif) Ligand 12, CXCL12, hIRH, Pre-B cell Growth-stimulating Factor, PBSF, SCYB12, TLSF-a, TPAR1) (AP) discontinued

Sign In for Pricing
View Details
CDK2 (Cell Division Protein Kinase 2, p33 Protein Kinase) (MaxLight 750) discontinued
124778-ML750 100 µL

CDK2 (Cell Division Protein Kinase 2, p33 Protein Kinase) (MaxLight 750) discontinued

Sign In for Pricing
View Details
OLFmL2A (NM_182487) Human Untagged Clone
SC318112 10 µg

OLFmL2A (NM_182487) Human Untagged Clone

Sign In for Pricing
View Details
SERPINE2 (Glia-derived Nexin, GDN, Peptidase Inhibitor 7, PI-7, Protease Nexin 1, PN-1, Protease Nexin I, Serpin E2, PI7, PN1) (HRP)
MBS6154903-01 0.1 mL

SERPINE2 (Glia-derived Nexin, GDN, Peptidase Inhibitor 7, PI-7, Protease Nexin 1, PN-1, Protease Nexin I, Serpin E2, PI7, PN1) (HRP)

Sign In for Pricing
View Details
SERPINE2 (Glia-derived Nexin, GDN, Peptidase Inhibitor 7, PI-7, Protease Nexin 1, PN-1, Protease Nexin I, Serpin E2, PI7, PN1) (HRP)
MBS6154903-02 5x 0.1 mL

SERPINE2 (Glia-derived Nexin, GDN, Peptidase Inhibitor 7, PI-7, Protease Nexin 1, PN-1, Protease Nexin I, Serpin E2, PI7, PN1) (HRP)

Sign In for Pricing
View Details
BC055004 (BC055004) Mouse Tagged ORF Clone
MR208658 10 µg

BC055004 (BC055004) Mouse Tagged ORF Clone

Sign In for Pricing
View Details