Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gloeobacter violaceus Photosystem Q (B) protein 2 (psbA2)

This Recombinant Gloeobacter violaceus Photosystem Q (B) protein 2 (psbA2) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 2, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 2, Photosystem II protein D1 2

UniProt

Q7NJX5

Expression Region

1-344

Origin

Gloeobacter violaceus (strain PCC 7421)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATILRRRSLGNPWEQFANWITSTDNRFYIGWFGVLMVPTLLSATICFVVAFIAAPPVDM DGIREPISGSLLYGNNIITGAVIPSSNAIGLHFYPIWEAASMDEWLYNGGPYQLVVFHFL IGIFAYLGREWEFSYRLGLRPWICVAYSAPVAAATAVFLIYPMGQGSFSDGMSLGISGTF NFMFIFQAEHNILNHPLHMFGVAGVFGGSLFAAMHGSLVTSSLIKATSYEESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFTNSRSLHFFLAAWPVIGIWLTSLGICVMGFNLNGF NFNASITDNQGRTIYTWADIVNRANLGIEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Inter Alpha-Globulin Inhibitor H5 (ITIH5) ELISA Kit
RD-ITIH5-Hu-48Tests 48 Tests

Human Inter Alpha-Globulin Inhibitor H5 (ITIH5) ELISA Kit

Sign In for Pricing
View Details
Human HDHD3 Knockout HEK293T cell line
GTR15421710 1 Vial

Human HDHD3 Knockout HEK293T cell line

Sign In for Pricing
View Details
CYP2A13 Polyclonal Conjugated Antibody
C40812 100 µL

CYP2A13 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
RFX4 siRNA (m)
sc-152827 10 µM

RFX4 siRNA (m)

Sign In for Pricing
View Details
Boc-His (Bzl) -OH
4007056.0005 5 g

Boc-His (Bzl) -OH

Sign In for Pricing
View Details
NPR2 (Natriuretic Peptide Receptor B/Guanylate Cyclase B (atrionatriuretic peptide Receptor B), AMDM, ANPRB, GUC2B, GUCY2B, NPRB, NPRBi) (AP)
MBS6162081-01 0.1 mL

NPR2 (Natriuretic Peptide Receptor B/Guanylate Cyclase B (atrionatriuretic peptide Receptor B), AMDM, ANPRB, GUC2B, GUCY2B, NPRB, NPRBi) (AP)

Sign In for Pricing
View Details