Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Protein YIPF3 (yipf3)

This Recombinant Danio rerio Protein YIPF3 (yipf3) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Protein YIPF3, YIP1 family member 3

UniProt

Q803Z2

Expression Region

1-344

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSASQGSKNTNAEPWGGFDDNIIQGTGSAVIDMENMDDTSGSSFEDVGEMHQRMREEEEV TAEAAATEEDNGEYGEFLGMKGLKGQLGRQVADEVWQAGKRQASKAFNLYANIDILRPYF DVEPIQVRNRLVESLIPVRMINFPQKVAGELYGPMMLVFTLVAILLHGMKTSGTVIREGT LMGTAIGTGFGYWLGVSSFIYFLAYLCNAQITMLQMLSLLGYGLFGHCVVLFITYNVHFH SLFYLLWMVIGGLSTLRMVAVLISRTVGQTPRLILCGSLAALHMLFLLYLHFAYHKMVEG ILDTLEGPNIPPIQRVARDVPVVASAVVNATVKSIAAIVQSQQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BOLA3 Antibody
OACA10078-50UG 50 µg

BOLA3 Antibody

Sign In for Pricing
View Details
C10orf10 (Chromosome 10 Open Reading Frame 10, DEPP, FIG)
243935 50 µg

C10orf10 (Chromosome 10 Open Reading Frame 10, DEPP, FIG)

Sign In for Pricing
View Details
Exosome Component 9 (EXOSC9, PMSCL1) (Biotin) discontinued
214822-Biotin 100 µL

Exosome Component 9 (EXOSC9, PMSCL1) (Biotin) discontinued

Sign In for Pricing
View Details
Human Forkhead Box Protein C1 FOXC1 ELISA Kit
BG-HUM10931 1 Each

Human Forkhead Box Protein C1 FOXC1 ELISA Kit

Sign In for Pricing
View Details
Poly-Gel RNA Purification Kit
RC3612-01 20 / Box

Poly-Gel RNA Purification Kit

Sign In for Pricing
View Details
TRPV1 peptide
orb218887-01 1 mg

TRPV1 peptide

Sign In for Pricing
View Details