Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein (psbA)

This Recombinant Photosystem Q (B) protein (psbA) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q9MUW0

Expression Region

1-344

Origin

Mesostigma viride

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATLERRESANLWGRFCEFITSTENRLYIGWFGVIMIPCLLTAISVYIIAFVAAPPVDI DGIREPVSGSLLYGNNIISGSVIPMSNAIGLHFYPIWEAASLDEWLYNGGPYLMVVCHFL LGIACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAVWPVVGIWFTAMGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgG (Fc specific) Goat Polyclonal Antibody
R1612B 2 mg

Mouse IgG (Fc specific) Goat Polyclonal Antibody

Sign In for Pricing
View Details
INTU Rabbit Polyclonal Antibody (Fluoro594)
orb3095255 100 µg

INTU Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
SCD1 AAV Vector (Mouse) (CMV)
43135104 1 µg

SCD1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
S100P Rabbit mAb
E2R50020 100 µL

S100P Rabbit mAb

Sign In for Pricing
View Details
KRTHA3B (KRT33B) (NM_002279) Human Over-expression Lysate
LH06107V 100 µg

KRTHA3B (KRT33B) (NM_002279) Human Over-expression Lysate

Sign In for Pricing
View Details
FcRH1 (E-8) Alexa Fluor® 680
sc-515003 AF680 200 µg/mL

FcRH1 (E-8) Alexa Fluor® 680

Sign In for Pricing
View Details