Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Conocephalum conicum Photosystem Q (B) protein (psbA)

This Recombinant Conocephalum conicum Photosystem Q (B) protein (psbA) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q9T351

Expression Region

1-344

Origin

Conocephalum conicum (Liverwort)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATLERRESASIWGRFCNWVTSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYEIIVLHFL LGVACYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rps15a sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4401903 1.0 µg DNA

Rps15a sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Ubtf 3'UTR Luciferase Stable Cell Line
TU121510 1.0 mL

Ubtf 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rat Protein S ELISA Kit
MBS3807834-01 48 Well

Rat Protein S ELISA Kit

Sign In for Pricing
View Details
Rat Protein S ELISA Kit
MBS3807834-02 96 Well

Rat Protein S ELISA Kit

Sign In for Pricing
View Details
Rat Protein S ELISA Kit
MBS3807834-03 5x 96 Well

Rat Protein S ELISA Kit

Sign In for Pricing
View Details
Rat Protein S ELISA Kit
MBS3807834-04 10x 96 Well

Rat Protein S ELISA Kit

Sign In for Pricing
View Details