Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Conocephalum conicum Photosystem Q (B) protein (psbA)

This Recombinant Conocephalum conicum Photosystem Q (B) protein (psbA) spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

Q9T351

Expression Region

1-344

Origin

Conocephalum conicum (Liverwort)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATLERRESASIWGRFCNWVTSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYEIIVLHFL LGVACYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SENP6 Human shRNA Plasmid Kit (Locus ID 26054)
TR301772 1 Kit

SENP6 Human shRNA Plasmid Kit (Locus ID 26054)

Sign In for Pricing
View Details
ZDBF2 rabbit pAb
UB-GEN-11922 100 µL

ZDBF2 rabbit pAb

Sign In for Pricing
View Details
Rabbit Polyclonal ODZ3 Antibody [Alexa Fluor 405]
NBP2-81974AF405 0.1 mL

Rabbit Polyclonal ODZ3 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Recombinant Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2)
SIPB803Hu01-01 10 µg

Recombinant Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2)

Sign In for Pricing
View Details
Recombinant Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2)
SIPB803Hu01-02 50 µg

Recombinant Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2)

Sign In for Pricing
View Details
Recombinant Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2)
SIPB803Hu01-03 200 µg

Recombinant Cholinergic Receptor, Nicotinic, Beta 2 (CHRNb2)

Sign In for Pricing
View Details