Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein

This Recombinant Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

P12719

Expression Region

1-344

Origin

Cyanophora paradoxa

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATLERNASVSLWEQFCGFITSTENRLYIGWFGVLMFPLLLTATTLFIIAFVAAPPVDI DGIREPVAGSLFYGNNIISGAVIPSSAAIGMHFYPIWEAASLDEWLYNGGPYQFVVMHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHMMGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLALWPVVGIWFTALGLSTMAFNLNGL NFNQSVVDSQGRVISTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGP9.5 / UchL1 (pan-Neuronal Marker) (rUCHL1/775), CF488A conjugate, 0.1mg/mL
BNC882205-500 1x 500 µL

PGP9.5 / UchL1 (pan-Neuronal Marker) (rUCHL1/775), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3,3’,5-Triiodo Thyropropionic Acid
TRC-T795410-50MG 50 mg

3,3’,5-Triiodo Thyropropionic Acid

Sign In for Pricing
View Details
RNF2 (NM_007212) Human Over-expression Lysate
LC402109 20 µg

RNF2 (NM_007212) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PRPF39 activation kit by CRISPRa
GA110454 1 Kit

Human PRPF39 activation kit by CRISPRa

Sign In for Pricing
View Details
DNAJB6 Antibody
KC-1835-01 50 μL

DNAJB6 Antibody

Sign In for Pricing
View Details
DNAJB6 Antibody
KC-1835-02 100 µL

DNAJB6 Antibody

Sign In for Pricing
View Details