Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein

This Recombinant Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

P24625

Expression Region

1-344

Origin

Antithamnion sp.

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATLERRESASLWARFCTWITMNENRLYIGWFGVVMIPTLLTATSVFIIACFAAPPVDI DGIREPVAGSLLYGNNIISGAIIPSSAAIGIHFYPIWEAASLDEWLYNGGPYQLIVLHFL LGVCCYIGREWEFSYRLGMRPWISVAFTAPVVAASAVFLVYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPLHQLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANNGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGLWPVVGIWFTSMSVSTMAFNLNGF NFNQSVVDSQGRVINTWADILNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cynomolgus CD132/IL2RG Protein, His Tag
KMP2162 100 µg

Recombinant Cynomolgus CD132/IL2RG Protein, His Tag

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae Cap-2 Protein (aa 2-287) [His]
VAng-Wyb4355-1mg 1 mg

Recombinant Saccharomyces Cerevisiae Cap-2 Protein (aa 2-287) [His]

Sign In for Pricing
View Details
Mouse IL-1ra/IL-1F3 ELISA Kit
EK2132-01 48 Tests

Mouse IL-1ra/IL-1F3 ELISA Kit

Sign In for Pricing
View Details
Mouse IL-1ra/IL-1F3 ELISA Kit
EK2132-02 96 Tests

Mouse IL-1ra/IL-1F3 ELISA Kit

Sign In for Pricing
View Details
Human NPHN (Nephrin) ELISA Kit
EK241550 96 Well

Human NPHN (Nephrin) ELISA Kit

Sign In for Pricing
View Details
Them5 (NM_025416) Mouse Tagged ORF Clone
MG212834 10 µg

Them5 (NM_025416) Mouse Tagged ORF Clone

Sign In for Pricing
View Details