Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein

This Recombinant Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

P24625

Expression Region

1-344

Origin

Antithamnion sp.

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATLERRESASLWARFCTWITMNENRLYIGWFGVVMIPTLLTATSVFIIACFAAPPVDI DGIREPVAGSLLYGNNIISGAIIPSSAAIGIHFYPIWEAASLDEWLYNGGPYQLIVLHFL LGVCCYIGREWEFSYRLGMRPWISVAFTAPVVAASAVFLVYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPLHQLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANNGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGLWPVVGIWFTSMSVSTMAFNLNGF NFNQSVVDSQGRVINTWADILNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 17A1 Rabbit Polyclonal Antibody (PE-Cy7)
orb899963 100 µL

Cytochrome P450 17A1 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Uchl1 3'UTR Luciferase Stable Cell Line
TU222808 1.0 mL

Uchl1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mystique CRISPR Activation Plasmid (h)
sc-405656-ACT 20 µg

Mystique CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Siah2 AAV siRNA Pooled Vector
43744164 1.0 µg

Siah2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CD56 Rabbit Polyclonal Antibody (BF594)
orb1579599 100 µL

CD56 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
IQCE Polyclonal Antibody, APC-Cy7 Conjugated
bs-9018R-APC-Cy7 100 µL

IQCE Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details