Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein

This Recombinant Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

P24625

Expression Region

1-344

Origin

Antithamnion sp.

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATLERRESASLWARFCTWITMNENRLYIGWFGVVMIPTLLTATSVFIIACFAAPPVDI DGIREPVAGSLLYGNNIISGAIIPSSAAIGIHFYPIWEAASLDEWLYNGGPYQLIVLHFL LGVCCYIGREWEFSYRLGMRPWISVAFTAPVVAASAVFLVYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPLHQLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANNGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGLWPVVGIWFTSMSVSTMAFNLNGF NFNQSVVDSQGRVINTWADILNRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GRK2 shRNA (UAS) - Lentiviral human GRK2 shRNA (UAS, iRFP) (100)
GTR15347886 1 Vial

Lentiviral human GRK2 shRNA (UAS) - Lentiviral human GRK2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
1H,4H,7H,8H-Imidazo[4,5-d][1,3]diazepin-8-one hydrochloride
OR1005368 1 Each

1H,4H,7H,8H-Imidazo[4,5-d][1,3]diazepin-8-one hydrochloride

Sign In for Pricing
View Details
Keratin 5 Rabbit pAb
MBS8541177-01 0.1 mL

Keratin 5 Rabbit pAb

Sign In for Pricing
View Details
Keratin 5 Rabbit pAb
MBS8541177-02 0.1 mL (AF405L)

Keratin 5 Rabbit pAb

Sign In for Pricing
View Details
Keratin 5 Rabbit pAb
MBS8541177-03 0.1 mL (AF405S)

Keratin 5 Rabbit pAb

Sign In for Pricing
View Details
Keratin 5 Rabbit pAb
MBS8541177-04 0.1 mL (AF610)

Keratin 5 Rabbit pAb

Sign In for Pricing
View Details