Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein

This Recombinant Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

P29270

Expression Region

1-344

Origin

Anabaena azollae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTLQQRSTANVWDRFCEWITSTENRIYIGWFGVLMIPTLVSAIACFVIAFIAAPPVDI DGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL IGVACYLGREWELSYRLGMRPWICVAFSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGVSTMAFNLNGF NFNQSIIDSQGRVIGTWADVINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 Spike RBD (K417N) (His Tag)
PKSV030364 100 µg

Recombinant SARS-CoV-2 Spike RBD (K417N) (His Tag)

Sign In for Pricing
View Details
MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), Biotin conjugate, 0.1mg/mL
BNCB2302-100 1x 100 µL

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF329 Mouse Monoclonal Antibody [Clone ID: OTI7F2]
CF809584 100 µg

ZNF329 Mouse Monoclonal Antibody [Clone ID: OTI7F2]

Sign In for Pricing
View Details
Serum Amyloid A (SAA/2868R), CF568 conjugate, 0.1mg/mL
BNC682868-100 1x 100 µL

Serum Amyloid A (SAA/2868R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Bcl2 Binding component 3 (BBC3) activation kit by CRISPRa
GA109015 1 Kit

Human Bcl2 Binding component 3 (BBC3) activation kit by CRISPRa

Sign In for Pricing
View Details
2-Ethylhexyl 14-Ethyl-6,6-dioctyl-4,8,11-trioxo-5,7,12-trioxa-6-stannaoctadeca-2,9-dienoate
TRC-E211400-500MG 500 mg

2-Ethylhexyl 14-Ethyl-6,6-dioctyl-4,8,11-trioxo-5,7,12-trioxa-6-stannaoctadeca-2,9-dienoate

Sign In for Pricing
View Details