Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein

This Recombinant Photosystem Q (B) protein spans the amino acid sequence from region 1-344.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

P29270

Expression Region

1-344

Origin

Anabaena azollae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTLQQRSTANVWDRFCEWITSTENRIYIGWFGVLMIPTLVSAIACFVIAFIAAPPVDI DGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL IGVACYLGREWELSYRLGMRPWICVAFSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGVSTMAFNLNGF NFNQSIIDSQGRVIGTWADVINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARK4 Human Gene Knockout Kit (CRISPR)
KN422580 1 Kit

MARK4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MATN1 (NM_002379) Human Over-expression Lysate
LC419364 20 µg

MATN1 (NM_002379) Human Over-expression Lysate

Sign In for Pricing
View Details
Human DIP2 homolog B (DIP2B) activation kit by CRISPRa
GA111630 1 Kit

Human DIP2 homolog B (DIP2B) activation kit by CRISPRa

Sign In for Pricing
View Details
SDCCAG10 (CWC27) Mouse Monoclonal Antibody [Clone ID: OTI4C1]
CF808676 100 µg

SDCCAG10 (CWC27) Mouse Monoclonal Antibody [Clone ID: OTI4C1]

Sign In for Pricing
View Details
Ethyl Ethanesulfonate
TRC-E676565-5G 5 g

Ethyl Ethanesulfonate

Sign In for Pricing
View Details
KDM3B Recombinant Rabbit Monoclonal Antibody [PSH0-11]
HA721252 100 µL

KDM3B Recombinant Rabbit Monoclonal Antibody [PSH0-11]

Sign In for Pricing
View Details