Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein

This Recombinant Photosystem Q (B) protein spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

P06631

Expression Region

1-345

Origin

Euglena gracilis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISPVLKKYARPSLWYRFCAWVASKKNRLYVGWFGVLMIPTLLTAATVFIIAFIAAPPVD IDGIREPVSGSLFYGNNIITGAVVPTSNAIGLHFYPIWEATSLDEWLYNGGPYQLIVCHF FIGICSYMGREWELSFRLGMRPWIAVAYSAPVAAASAVFIVYPLGQGSFSDGMPLGISGT FNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLLRETTENESINVGYKF GQEEETYNIIAAHAYFGRLIFQYASFNNSRSLHFFLAVWPVVGIWFTALGVSTMAFNLNG FNFNQSVIDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAPK4 (MAPK13) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C7]
TA505866AM 100 µL

SAPK4 (MAPK13) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C7]

Sign In for Pricing
View Details
IRF2BP1 Mouse Monoclonal Antibody [Clone ID: OTI6C9]
CF811713 100 µg

IRF2BP1 Mouse Monoclonal Antibody [Clone ID: OTI6C9]

Sign In for Pricing
View Details
KIR2DL4 Rabbit Polyclonal Antibody
TA377816 100 µL

KIR2DL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery: carotid
CS510108 5x 5 µm

Frozen Tissue Sections, Artery: carotid

Sign In for Pricing
View Details
Giardia lamblia (BB1.1E5), CF647 conjugate, 0.1mg/mL
BNC470210-100 1x 100 µL

Giardia lamblia (BB1.1E5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Cdx1 activation kit by CRISPRa
GA200687 1 Kit

Mouse Cdx1 activation kit by CRISPRa

Sign In for Pricing
View Details