Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem Q (B) protein

This Recombinant Photosystem Q (B) protein spans the amino acid sequence from region 1-345.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

P06631

Expression Region

1-345

Origin

Euglena gracilis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISPVLKKYARPSLWYRFCAWVASKKNRLYVGWFGVLMIPTLLTAATVFIIAFIAAPPVD IDGIREPVSGSLFYGNNIITGAVVPTSNAIGLHFYPIWEATSLDEWLYNGGPYQLIVCHF FIGICSYMGREWELSFRLGMRPWIAVAYSAPVAAASAVFIVYPLGQGSFSDGMPLGISGT FNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLLRETTENESINVGYKF GQEEETYNIIAAHAYFGRLIFQYASFNNSRSLHFFLAVWPVVGIWFTALGVSTMAFNLNG FNFNQSVIDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERCA2 (ATP2A2) Mouse Monoclonal Antibody [Clone ID: OTI4B12]
CF812109 100 µg

SERCA2 (ATP2A2) Mouse Monoclonal Antibody [Clone ID: OTI4B12]

Sign In for Pricing
View Details
ANGPTL6 Rabbit Polyclonal Antibody
TA371959 100 µL

ANGPTL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Vinylphenol, 10 wt.% In Propylene Glycol
TRC-V453313-50MG 50 mg

4-Vinylphenol, 10 wt.% In Propylene Glycol

Sign In for Pricing
View Details
MEAK7 (TLDC1) (NM_020947) Human Over-expression Lysate
LC402813 20 µg

MEAK7 (TLDC1) (NM_020947) Human Over-expression Lysate

Sign In for Pricing
View Details
LI Cadherin (CDH17) Human Gene Knockout Kit (CRISPR)
KN211298 1 Kit

LI Cadherin (CDH17) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CENPE Recombinant Rabbit monoclonal Antibody
HA750888 100 µL

CENPE Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details